TA346389 IGFALS / ALS antibody

Rabbit Polyclonal Anti-IGFALS Antibody

See related secondary antibodies

Search for all "IGFALS / ALS"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Mouse, Rat IGFALS / ALS

Product Description for IGFALS / ALS

Rabbit anti Guinea Pig, Human, Mouse, Rat IGFALS / ALS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IGFALS / ALS

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Insulin-like growth factor-binding protein complex acid labile chain
Presentation Purified
Reactivity GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35858
Immunogen:
The immunogen for anti-IGFALS antibody: synthetic peptide directed towards the middle region of human IGFALS. Synthetic peptide located within the following region: DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE.
GeneID:
3483
Application WB
Background Adaptor proteins are usually required for transcriptional activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter.TADA3L is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IGFALS / ALS (4 products)

Catalog No. Species Pres. Purity   Source  

IGFALS / ALS

IGFALS / ALS Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

IGFALS / ALS

IGFALS / ALS Human
  Abnova Taiwan Corp.

IGFALS / ALS

IGFALS / ALS Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

IGFALS / ALS

IGFALS / ALS Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for IGFALS / ALS (1 products)

Catalog No. Species Pres. Purity   Source  

IGFALS Lysate

Western Blot: IGFALS Lysate [NBL1-11872] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IGFALS
  Novus Biologicals Inc.
  • LinkedIn