TA346388 IGFALS / ALS antibody

Rabbit Polyclonal Anti-IGFALS Antibody

See related secondary antibodies

Search for all "IGFALS / ALS"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat IGFALS / ALS

Product Description for IGFALS / ALS

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat IGFALS / ALS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IGFALS / ALS

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Insulin-like growth factor-binding protein complex acid labile chain
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-IGFALS antibody: synthetic peptide directed towards the middle region of human IGFALS. Synthetic peptide located within the following region: PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG.
Application WB
Background IGFALS is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in IGFALS are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty.
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for IGFALS / ALS (4 products)

Catalog No. Species Pres. Purity   Source  


IGFALS / ALS Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


  Abnova Taiwan Corp.


IGFALS / ALS Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.


IGFALS / ALS Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for IGFALS / ALS (1 products)

Catalog No. Species Pres. Purity   Source  


Western Blot: IGFALS Lysate [NBL1-11872] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IGFALS
  Novus Biologicals Inc.
  • LinkedIn