TA333353 IGFL1 antibody

Rabbit Polyclonal Anti-IGFL1 Antibody

See related secondary antibodies

Search for all "IGFL1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human IGFL1

Product Description for IGFL1

Rabbit anti Human IGFL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IGFL1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Insulin growth factor-like family member 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UW32
Immunogen:
The immunogen for Anti-IGFL1 Antibody is: synthetic peptide directed towards the C-terminal region of Human IGFL1. Synthetic peptide located within the following region: AVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRS.
GeneID:
374918
Application WB
Background IGFL1 belongs to the insulin-like growth factor family of sigling molecules that play critical roles in cellular energy metabolism and in growth and development, especially pretal growth.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IGFL1 (1 products)

Catalog No. Species Pres. Purity   Source  

IGFL1

IGFL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for IGFL1 (2 products)

Catalog No. Species Pres. Purity   Source  

IGFL1 Lysate

Western Blot: IGFL1 Lysate [NBL1-11877] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for IGFL1.
  Novus Biologicals Inc.

IGFL1 overexpression lysate

IGFL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn