discontinued

H00003494-D01P IGHA2 antibody

See related secondary antibodies

Search for all "IGHA2"

Quick Overview

Rabbit anti Human IGHA2

Product Description for IGHA2

Rabbit anti Human IGHA2.
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for IGHA2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Ig alpha-2 chain C region
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P01877
Immunogen:
IGHA2 (AAH73765.1, 1 a.a. ~ 477 a.a) full-length human protein.
AA Sequence:
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQTAGKGLEWIGYISHSGST TYNPSLKSRVTLSLDTSKNQFSLRLNSVTAADTAVYYCAHGSSWDFAFDYWGQGTLVTVSSASPTSPKVFPLSLDS TPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYT NPSQDVTVPCPVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLC GCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFS PKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRL AGKPTHVNVSVVMAEVDGTCY
GeneID:
3494
Remarks:
Gene Accession: BC073765.1
Add. information Rabbit polyclonal antibody raised against a full-length human IGHA2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
Specificity
Species:
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for IGHA2 (2 products)

Catalog No. Species Pres. Purity   Source  

IGHA2

IGHA2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IGHA2

IGHA2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for IGHA2 (1 products)

Catalog No. Species Pres. Purity   Source  

IGHA2 293T Cell Transient Overexpression Lysate(Denatured)

IGHA2 293T Cell Transient Overexpression Lysate(Denatured) Transient overexpression cell lysate was tested with Anti-IGHA2 antibody (H00003494-B01) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn