discontinued

H00003514-B01 IGKC antibody

See related secondary antibodies

Search for all "IGKC"

Quick Overview

Mouse anti Human IGKC

H00003514-B01

More Views

  • H00003514-B01

Product Description for IGKC

Mouse anti Human IGKC.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot, Paraffin Sections.

Properties for IGKC

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Ig kappa chain C region
Presentation Serum
Reactivity Hu
Applications E(detection), P, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P01834
Immunogen:
IGKC (AAH66343.1, 1 a.a. ~ 234 a.a) full-length human protein.
AA Sequence:
MEAPAQLLFLLLLWLPDTTGEIVLTQSPVFLSLSPGEGATLSCRASQSVSRNLAWYQQKSGQAPRLLIYDASNRAT GIPARFSGSGSGTDFTLTISSLEPEDSAVYYCQQRSNCLITFGQGTRLEIRRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKS FNRGEC
Remarks:
Gene Accession: BC066343.1
Add. information Mouse polyclonal antibody raised against a full-length human IGKC protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IHC-P,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for IGKC (2 products)

Catalog No. Species Pres. Purity   Source  

IGKC

IGKC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IGKC

IGKC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for IGKC (1 products)

Catalog No. Species Pres. Purity   Source  

IGKC 293T Cell Transient Overexpression Lysate(Denatured)

IGKC 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn