H00003514-D01 IGKC antibody

See related secondary antibodies

Search for all "IGKC"

0.1 ml / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse IGKC

H00003514-D01

Product Description for IGKC

Rabbit anti Human, Mouse IGKC.
Product is tested for Immunoprecipitation, Western blot / Immunoblot.

Properties for IGKC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HCAK1, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809
Reactivity Hu, Ms
Applications IP, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P01601
Immunogen:
IGKC (AAH66343.1, 1 a.a. ~ 234 a.a) full-length human protein.
AA Sequence:
MEAPAQLLFLLLLWLPDTTGEIVLTQSPVFLSLSPGEGATLSCRASQSVSRNLAWYQQKSGQAPRLLIYDASNRAT GIPARFSGSGSGTDFTLTISSLEPEDSAVYYCQQRSNCLITFGQGTRLEIRRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKS FNRGEC
GeneID:
3514
Add. information Rabbit polyclonal antibody raised against a full-length human IGKC protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn