H00028862-M01 IGKV1OR2-108 antibody

See related secondary antibodies

Search for all "IGKV1OR2-108"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human IGKV1OR2-108 3A11

H00028862-M01

Product Description for IGKV1OR2-108

Mouse anti Human IGKV1OR2-108 3A11.
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence.

Properties for IGKV1OR2-108

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms IGKV1OR2108, IGO1
Reactivity Hu
Applications E, ICC/IF
Clonality Monoclonal
Clone 3A11
Host Mouse
Isotype IgG2a
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
IGKV1OR2-108 (CAA36171.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
DIQVTQSPSSLSASVGDRVTITCRASQGISNGLSWYQQKPGQAPTLLIYAASSLQSGVPSRFSGSGSGTDFTLTIS SLQPEDVATYYCLQDYTTP
GeneID:
28862
Add. information Mouse monoclonal antibody raised against a partial recombinant IGKV1OR2-108.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody Reactive Against Recombinant Protein.

Accessory Products

  • LinkedIn