TA337352 IGSF22 antibody

Rabbit Polyclonal Anti-IGSF22 Antibody

See related secondary antibodies

Search for all "IGSF22"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human IGSF22

Product Description for IGSF22

Rabbit anti Canine, Human IGSF22.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IGSF22

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Immunoglobulin superfamily member 22
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N9C0
Immunogen:
The immunogen for Anti-IGSF22 antibody is: synthetic peptide directed towards the N-terminal region of Human IGSF22. Synthetic peptide located within the following region: NKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKM.
GeneID:
283284
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn