NBP1-93696 INO80B antibody

See related secondary antibodies

Search for all "INO80B"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human INO80B

NBP1-93696

More Views

  • NBP1-93696

Product Description for INO80B

Rabbit anti Human INO80B.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections.

Properties for INO80B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9C086
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PMVRYCSGAQGSTLSFPPGVPAPTAVSQRPSPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMRLGGPEGPGS
GeneID:
83444
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 83444

Accessory Products

Proteins and/or Positive Controls

Positive controls for INO80B (1 products)

Catalog No. Species Pres. Purity   Source  

INO80B overexpression lysate

INO80B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn