H00283899-B01P INO80E antibody

See related secondary antibodies

Search for all "INO80E"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human INO80E

H00283899-B01P

Product Description for INO80E

Mouse anti Human INO80E.
Product is tested for Western blot / Immunoblot.

Properties for INO80E

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms CCDC95, FLJ00079, FLJ90652
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NBZ0
Immunogen:
INO80E (NP_775889.1, 1 a.a. ~ 244 a.a) full-length human protein.
AA Sequence:
MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASS DNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPE PSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSG DDALDGDDDLVIDIPE
GeneID:
283899
Add. information Mouse polyclonal antibody raised against a full-length human INO80E protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for INO80E (1 products)

Catalog No. Species Pres. Purity   Source  

INO80 complex subunit E (INO80E)

INO80 complex subunit E (INO80E) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for INO80E (2 products)

Catalog No. Species Pres. Purity   Source  

INO80E Lysate

Western Blot: INO80E Lysate [NBL1-08834] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for INO80E
0.1 mg / €400.00
  Novus Biologicals Inc.

INO80E overexpression lysate

INO80E overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn