NBP1-86578 INO80E antibody

See related secondary antibodies

Search for all "INO80E"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human INO80E

NBP1-86578

More Views

  • NBP1-86578
  • NBP1-86578

Product Description for INO80E

Rabbit anti Human INO80E.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for INO80E

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NBZ0
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDD
GeneID:
283899
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 283899

Accessory Products

Proteins and/or Positive Controls

Proteins for INO80E (1 products)

Catalog No. Species Pres. Purity   Source  

INO80 complex subunit E (INO80E)

INO80 complex subunit E (INO80E) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for INO80E (2 products)

Catalog No. Species Pres. Purity   Source  

INO80E Lysate

Western Blot: INO80E Lysate [NBL1-08834] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for INO80E
0.1 mg / €400.00
  Novus Biologicals Inc.

INO80E overexpression lysate

INO80E overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn