NBP1-59729 Insig1 antibody

See related secondary antibodies

Search for all "Insig1"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Xenopus Insig1

Product Description for Insig1

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Xenopus Insig1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Insig1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CL-6, MGC1405
Presentation Aff - Purified
Reactivity Bov, Can, Chk, Hu, Ms, Rt, Xen
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to INSIG1(insulin induced gene 1) The peptide sequence was selected from the middle region of INSIG1. Peptide sequence ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR.
Background Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane prote
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 3638

Accessory Products

  • LinkedIn