TA345660 INSIG2 antibody

Rabbit Polyclonal Anti-INSIG2 Antibody

See related secondary antibodies

Search for all "INSIG2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep INSIG2

Product Description for INSIG2

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep INSIG2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for INSIG2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms INSIG-2, Insulin-induced gene 2 protein
Presentation Purified
Reactivity Bov, Can, Eq, Gt, Hu, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-INSIG2 antibody: synthetic peptide directed towards the N terminal of human INSIG2. Synthetic peptide located within the following region: MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ.
Application WB
Background INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for INSIG2 (3 products)

Catalog No. Species Pres. Purity   Source  


INSIG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


INSIG2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


INSIG2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for INSIG2 (1 products)

Catalog No. Species Pres. Purity   Source  

INSIG2 Lysate

Western Blot:INSIG-2  Lysate [NBL1-12004] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for INSIG-2
  Novus Biologicals Inc.
  • LinkedIn