discontinued

GTX28986 Integrin alpha 3a [158A3] antibody

See related secondary antibodies

Search for all "Integrin alpha 3a [158A3]"

0.1 mg / €410.00

Quick Overview

Mouse anti Human Integrin alpha 3a [158A3] 158A3

GTX28986

Product Description for Integrin alpha 3a [158A3]

Mouse anti Human Integrin alpha 3a [158A3] 158A3.
Presentation: Purified
Product is tested for Frozen Sections, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for Integrin alpha 3a [158A3]

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications C, ICC/IF, WB
Clonality Monoclonal
Clone 158A3
Host Mouse
Isotype IgG1
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer GeneTex Inc.

Datasheet Extract

Immunogen
Immunogen:
Synthetic peptide: C-RTRALYEAKRQKAEMKSQPSETERLTDDY conjugated to KLH.
Isotype control AM03095PU-N, SM10P (for use in human samples)
Application ICC, IHC-Fr, WB
Background Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha 3 and alpha 6, two cytoplasmic variants, A and B, have been identified.
Concentration 1 mg/ml
Storage Keep as concentrated solution. Store at 4
Format
Purification:
Protein A affinity purified.
Buffer System:
PBS, 0.1% Sodium Azide
Purity:
Protein A affinity purified.
State:
Purified
Specificity
Specificity:
Cross-reacts with Human. Expected to cross-react with a wide range of species due to sequence homology. Not yet tested in other species.

Accessory Products

  • LinkedIn