
GTX28985 Integrin alpha 3a [29A3] antibody

See related secondary antibodies

Search for all "Integrin alpha 3a [29A3]"

0.1 mg / €410.00

Quick Overview

Mouse anti Human Integrin alpha 3a [29A3] 29A3


Product Description for Integrin alpha 3a [29A3]

Mouse anti Human Integrin alpha 3a [29A3] 29A3.
Presentation: Purified
Product is tested for Frozen Sections, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for Integrin alpha 3a [29A3]

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications C, ICC/IF, WB
Clonality Monoclonal
Clone 29A3
Host Mouse
Isotype IgG1
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer GeneTex Inc.

Datasheet Extract

Synthetic peptide: C-RTRALYEAKRQKAEMKSQPSETERLTDDY conjugated to KLH.
Isotype control AM03095PU-N, SM10P (for use in human samples)
Application ICC, IHC-Fr, WB
Background The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.
Concentration 1 mg/ml
Storage Keep as concentrated solution. Store at 4
Protein G affinity purified.
Buffer System:
Preservative: 0.09% Sodium Azide; Constituents: PBS
Protein G affinity purified.
Cross-reacts with Human. Expected to cross-react with a wide range of species due to sequence homology. Not yet tested in other species.

Accessory Products

  • LinkedIn