discontinued

H00003600-B01 Interleukin-15 / IL15 antibody

See related secondary antibodies

Search for all "Interleukin-15 / IL15"

Quick Overview

Mouse anti Human Interleukin-15 / IL15

Product Description for Interleukin-15 / IL15

Mouse anti Human Interleukin-15 / IL15.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Interleukin-15 / IL15

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms IL-15
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P40933
Immunogen:
IL15 (NP_000576, 1 a.a. ~ 162 a.a) full-length human protein.
AA Sequence:
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTE SDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFV HIVQMFINTS
GeneID:
3600
Remarks:
Gene Accession: NM_000585
Add. information Mouse polyclonal antibody raised against a full-length human IL15 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 3600

Accessory Products

Proteins and/or Positive Controls

Proteins for Interleukin-15 / IL15 (21 products)

Catalog No. Species Pres. Purity   Source  

Interleukin-15 / IL15

Interleukin-15 / IL15 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

Interleukin-15 / IL15 (transcript variant 3)

Interleukin-15 / IL15 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €139.00
  OriGene Technologies, Inc.

Interleukin-15 / IL15 (transcript variant 3)

Interleukin-15 / IL15 Human > 98 %
Preparation: .
Purity Detail: Purity is >98%, as determined by Coomassie stained SDS-PAGE.
E. coli
10 µg / €164.00
  OriGene Technologies, Inc.

Interleukin-15 / IL15 (49-162, His-tag)

Interleukin-15 / IL15 Human Purified > 95 % by SDS PAGE E. coli
0.5 mg / €1,000.00
  OriGene Technologies GmbH

Interleukin-15 / IL15 (49-162, His-tag)

Interleukin-15 / IL15 Human Purified > 95 % by SDS PAGE E. coli
0.1 mg / €370.00
  OriGene Technologies GmbH

Interleukin-15 / IL15

Interleukin-15 / IL15 Human > 98 % > 98% pure by SDS-PAGE and HPLC analyses E. coli
  OriGene Technologies GmbH

Interleukin-15 / IL15

Interleukin-15 / IL15 Human > 98 % > 98% pure by SDS-PAGE and HPLC analyses E. coli
  OriGene Technologies GmbH

Interleukin-15 / IL15

Precursor- Protein structure and amino acid sequence Human Purified > 98 % Purified by proprietary chromatographic techniques, sterile filtered, purity greater than 98.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

Interleukin-15 / IL15

Precursor- Protein structure and amino acid sequence Human Purified > 98 % Purified by proprietary chromatographic techniques, sterile filtered, purity greater than 98.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

Interleukin-15 / IL15

Precursor- Protein structure and amino acid sequence Human Purified > 98 % Purified by proprietary chromatographic techniques, sterile filtered, purity greater than 98.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

Interleukin-15 / IL15

Interleukin-15 / IL15 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Interleukin-15 / IL15

Interleukin-15 / IL15 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Interleukin-15 / IL15

Interleukin-15 / IL15 Human Purified
  Abnova Taiwan Corp.

Interleukin-15 / IL15

Interleukin-15 / IL15 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Interleukin-15 / IL15

Interleukin-15 / IL15 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Interleukin-15 / IL15

Interleukin-15 / IL15 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Interleukin-15 / IL15

Interleukin-15 / IL15 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Interleukin-15 / IL15

Interleukin-15 / IL15 Human
  Abnova Taiwan Corp.

Interleukin-15 / IL15

Interleukin-15 / IL15 Human
  Abnova Taiwan Corp.

Interleukin-15 / IL15

SDS-Page: IL15 Protein [NBC1-18480] - Interleukin-15, 13.9kDa (123aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Interleukin-15 / IL15

Interleukin-15 / IL15 Human Purified
  Novus Biologicals Inc.

Positive controls for Interleukin-15 / IL15 (2 products)

Catalog No. Species Pres. Purity   Source  

IL15 293T Cell Transient Overexpression Lysate(Denatured)

IL15 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IL15 Lysate

Western Blot: IL15 Lysate [NBL1-11907] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IL15
  Novus Biologicals Inc.
  • LinkedIn