discontinued

H00055756-B01 INTS9 / RC74 antibody

See related secondary antibodies

Search for all "INTS9 / RC74"

Quick Overview

Mouse anti Human INTS9 / RC74

Product Description for INTS9 / RC74

Mouse anti Human INTS9 / RC74.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for INTS9 / RC74

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Int9, Integrator complex subunit 9, Protein related to CPSF subunits of 74 kDa, RC-74
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NV88
Immunogen:
RC74 (AAH25267.1, 1 a.a. ~ 658 a.a) full-length human protein.
AA Sequence:
MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKECSGHVF VDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEELVNFIERVPKAQS ASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQ SHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCYPSGV IYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIH GDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQ VSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIK PGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKV EDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF
GeneID:
55756
Remarks:
Gene Accession: BC025267
Add. information Mouse polyclonal antibody raised against a full-length human RC74 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 55756

Accessory Products

Proteins and/or Positive Controls

Proteins for INTS9 / RC74 (3 products)

Catalog No. Species Pres. Purity   Source  

INTS9 / RC74 (transcript variant 1)

INTS9 / RC74 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

INTS9 / RC74

INTS9 / RC74 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

INTS9 / RC74

INTS9 / RC74 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for INTS9 / RC74 (3 products)

Catalog No. Species Pres. Purity   Source  

INTS9 overexpression lysate

INTS9 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

RC74 293T Cell Transient Overexpression Lysate(Denatured)

RC74 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RC74 Lysate

Western Blot: RC74 Lysate [NBL1-12012] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for INTS9
  Novus Biologicals Inc.
  • LinkedIn