discontinued

H00080271-B01 IP3 3-kinase C / ITPKC antibody

See related secondary antibodies

Search for all "IP3 3-kinase C / ITPKC"

Quick Overview

Mouse anti Human IP3 3-kinase C / ITPKC

Product Description for IP3 3-kinase C / ITPKC

Mouse anti Human IP3 3-kinase C / ITPKC.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for IP3 3-kinase C / ITPKC

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms 4, 5-trisphosphate 3-kinase C, IP3K-C, IP3KC, Inositol 1, Inositol-trisphosphate 3-kinase C, InsP3-kinase C
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96DU7
Immunogen:
ITPKC (NP_079470.1, 1 a.a. ~ 683 a.a) full-length human protein.
AA Sequence:
MRRCPCRGSLNEAEAGALPAAARMGLEAPRGGRRRQPGQQRPGPGAGAPAGRPEGGGPWARTEGSSLHSEPERAGL GPAPGTESPQAEFWTDGQTEPAAAGLGVETERPKQKTEPDRSSLRTHLEWSWSELETTCLWTETGTDGLWTDPHRS DLQFQPEEASPWTQPGVHGPWTELETHGSQTQPERVKSWADNLWTHQNSSSLQTHPEGACPSKEPSADGSWKELYT DGSRTQQDIEGPWTEPYTDGSQKKQDTEAARKQPGTGGFQIQQDTDGSWTQPSTDGSQTAPGTDCLLGEPEDGPLE EPEPGELLTHLYSHLKCSPLCPVPRLIITPETPEPEAQPVGPPSRVEGGSGGFSSASSFDESEDDVVAGGGGASDP EDRSGSKPWKKLKTVLKYSPFVVSFRKHYPWVQLSGHAGNFQAGEDGRILKRFCQCEQRSLEQLMKDPLRPFVPAY YGMVLQDGQTFNQMEDLLADFEGPSIMDCKMGSRTYLEEELVKARERPRPRKDMYEKMVAVDPGAPTPEEHAQGAV TKPRYMQWRETMSSTSTLGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVDGDHVILQKYVACLEELREALEI SPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQTLSHRLPWAEGNREDGYLWGLDNMICLLQGLAQS
GeneID:
80271
Remarks:
Gene Accession: NM_025194.2
Add. information Mouse polyclonal antibody raised against a full-length human ITPKC protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 80271

Accessory Products

Proteins and/or Positive Controls

Proteins for IP3 3-kinase C / ITPKC (5 products)

Catalog No. Species Pres. Purity   Source  

IP3 3-kinase C / ITPKC

IP3 3-kinase C / ITPKC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

IP3 3-kinase C / ITPKC

IP3 3-kinase C / ITPKC Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IP3 3-kinase C / ITPKC

IP3 3-kinase C / ITPKC Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IP3 3-kinase C / ITPKC

IP3 3-kinase C / ITPKC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IP3 3-kinase C / ITPKC

IP3 3-kinase C / ITPKC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for IP3 3-kinase C / ITPKC (1 products)

Catalog No. Species Pres. Purity   Source  

ITPKC 293T Cell Transient Overexpression Lysate(Denatured)

ITPKC 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn