discontinued

H00003654-B01P IRAK1 antibody

See related secondary antibodies

Search for all "IRAK1"

Quick Overview

Mouse anti Human IRAK1

Product Description for IRAK1

Mouse anti Human IRAK1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for IRAK1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms IRAK, IRAK-1, Interleukin-1 receptor-associated kinase 1
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P51617
Immunogen:
IRAK1 (AAH14963.1, 1 a.a. ~ 633 a.a) full-length human protein.
AA Sequence:
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINR NARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQT HSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPSPFCWPLCEISRGTHNFSEELKIGEGGFGCVYR AVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRLHCQT QACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFGLARFSRFAGSSPSQSSMVAR TQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAGQRAVKTHGARTKYLVYERLEKLQAVVAGVPGHLEAA SCIPPSPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLD PAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLL SSSSLPGLGLEQDRQGPEESDEFQS
GeneID:
3654
Remarks:
Gene Accession: BC014963.1
Add. information Mouse polyclonal antibody raised against a full-length human IRAK1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3654

Accessory Products

Proteins and/or Positive Controls

Proteins for IRAK1 (9 products)

Catalog No. Species Pres. Purity   Source  

IRAK1 (transcript variant 3)

IRAK1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

IRAK1

IRAK1 Human
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human
  Abnova Taiwan Corp.

Positive controls for IRAK1 (6 products)

Catalog No. Species Pres. Purity   Source  

IRAK1 293T Cell Transient Overexpression Lysate(Denatured)

IRAK1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IRAK1 overexpression lysate

IRAK1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

IRAK1 overexpression lysate

IRAK1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

IRAK1 overexpression lysate

IRAK1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

IRAK Lysate

Western Blot: IRAK Lysate [NBL1-12025] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IRAK1
  Novus Biologicals Inc.

IRAK Lysate

Western Blot: IRAK Lysate [NBL1-12026] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IRAK1
  Novus Biologicals Inc.
  • LinkedIn