discontinued

H00003654-M02 IRAK1 antibody

See related secondary antibodies

Search for all "IRAK1"

Quick Overview

Mouse anti Human IRAK1 3A9

H00003654-M02

More Views

  • H00003654-M02
  • H00003654-M02
  • H00003654-M02
  • H00003654-M02
  • H00003654-M02

Product Description for IRAK1

Mouse anti Human IRAK1 3A9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, Paraffin Sections.

Properties for IRAK1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms IRAK, IRAK-1, Interleukin-1 receptor-associated kinase 1
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, P, WB
Clonality Monoclonal
Clone 3A9
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P51617
Immunogen:
IRAK1 (AAH54000, 530 a.a. ~ 693 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
SSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGD TAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQD RQGPEESDEFQS
GeneID:
3654
Remarks:
Gene Accession: BC054000
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant IRAK1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,IHC-P,RNAi-Ab,S-ELISA,WB-Ce,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3654

Accessory Products

Proteins and/or Positive Controls

Proteins for IRAK1 (9 products)

Catalog No. Species Pres. Purity   Source  

IRAK1 (transcript variant 3)

IRAK1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

IRAK1

IRAK1 Human
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human
  Abnova Taiwan Corp.

IRAK1

IRAK1 Human
  Abnova Taiwan Corp.

Positive controls for IRAK1 (6 products)

Catalog No. Species Pres. Purity   Source  

IRAK1 293T Cell Transient Overexpression Lysate(Denatured)

IRAK1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IRAK1 overexpression lysate

IRAK1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

IRAK1 overexpression lysate

IRAK1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

IRAK1 overexpression lysate

IRAK1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

IRAK Lysate

Western Blot: IRAK Lysate [NBL1-12025] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IRAK1
  Novus Biologicals Inc.

IRAK Lysate

Western Blot: IRAK Lysate [NBL1-12026] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IRAK1
  Novus Biologicals Inc.
  • LinkedIn