discontinued

H00003659-B01 IRF1 antibody

See related secondary antibodies

Search for all "IRF1"

Quick Overview

Mouse anti Human IRF1

H00003659-B01

More Views

  • H00003659-B01

Product Description for IRF1

Mouse anti Human IRF1.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for IRF1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms IRF-1, Interferon regulatory factor 1
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P10914
Immunogen:
IRF1 (NP_002189.1, 1 a.a. ~ 325 a.a) full-length human protein.
AA Sequence:
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKT WKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGL SSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDED EEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDAT WLDSLLTPVRLPSIQAIPCAP
GeneID:
3659
Remarks:
Gene Accession: NM_002198.1
Add. information Mouse polyclonal antibody raised against a full-length human IRF1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 3659

Accessory Products

Proteins and/or Positive Controls

Proteins for IRF1 (11 products)

Catalog No. Species Pres. Purity   Source  

IRF1

IRF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

IRF1 (1-114, His-tag)

IRF1 Human Purified ≥ 90 by SDS-PAGE E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

IRF1 (1-114, His-tag)

IRF1 Human Purified ≥ 90 by SDS-PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

IRF1

IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

IRF1

IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

IRF1

IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

SDS-Page: IRF1 Protein [NBC1-18471] - IRF1, 15 kDa (134 aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for IRF1 (2 products)

Catalog No. Species Pres. Purity   Source  

IRF1 293T Cell Transient Overexpression Lysate(Denatured)

IRF1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IRF1 Lysate

Western Blot: IRF1 Lysate [NBL1-12030] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IRF1
  Novus Biologicals Inc.
  • LinkedIn