TA329237 IRF1 antibody

Rabbit Polyclonal anti-IRF1 antibody

See related secondary antibodies

Search for all "IRF1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human IRF1

Product Description for IRF1

Rabbit anti Human IRF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IRF1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms IRF-1, Interferon regulatory factor 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P10914
Immunogen:
The immunogen for anti-IRF1 antibody: synthetic peptide directed towards the N terminal of human IRF1. Synthetic peptide located within the following region: RMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPD.
GeneID:
3659
Application WB
Background IRF1 is interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppressoion.IRF1 encodes interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppressoion.IRF1 encodes interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppressoion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IRF1 (11 products)

Catalog No. Species Pres. Purity   Source  

IRF1

IRF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

IRF1 (1-114, His-tag)

IRF1 Human Purified ≥ 90 by SDS-PAGE E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

IRF1 (1-114, His-tag)

IRF1 Human Purified ≥ 90 by SDS-PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

IRF1

IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

IRF1

IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

IRF1

IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

SDS-Page: IRF1 Protein [NBC1-18471] - IRF1, 15 kDa (134 aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for IRF1 (2 products)

Catalog No. Species Pres. Purity   Source  

IRF1 293T Cell Transient Overexpression Lysate(Denatured)

IRF1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IRF1 Lysate

Western Blot: IRF1 Lysate [NBL1-12030] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IRF1
  Novus Biologicals Inc.
  • LinkedIn