TA335847 IRF1 antibody

Rabbit Polyclonal Anti-IRF1 Antibody

See related secondary antibodies

Search for all "IRF1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Rat, Sheep IRF1

Product Description for IRF1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Rat, Sheep IRF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IRF1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms IRF-1, Interferon regulatory factor 1
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-IRF1 Antibody is: synthetic peptide directed towards the C-terminal region of IRF1. Synthetic peptide located within the following region: YLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATW.
Application WB
Background IRF1 is interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded R induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppressoion.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for IRF1 (11 products)

Catalog No. Species Pres. Purity   Source  


IRF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH


IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH


IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

IRF1 (1-114, His-tag)

IRF1 Human Purified ≥ 90 by SDS-PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

IRF1 (1-114, His-tag)

IRF1 Human Purified ≥ 90 by SDS-PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH


IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


SDS-Page: IRF1 Protein [NBC1-18471] - IRF1, 15 kDa (134 aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for IRF1 (2 products)

Catalog No. Species Pres. Purity   Source  

IRF1 293T Cell Transient Overexpression Lysate(Denatured)

IRF1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IRF1 Lysate

Western Blot: IRF1 Lysate [NBL1-12030] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IRF1
  Novus Biologicals Inc.
  • LinkedIn