TA341785 IRF1 antibody

Rabbit Polyclonal Anti-Irf1 Antibody

See related secondary antibodies

Search for all "IRF1"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast IRF1

Product Description for IRF1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast IRF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IRF1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms IRF-1, Interferon regulatory factor 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Sh, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P10914
Immunogen:
The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPT.
GeneID:
3659
Application WB
Background Irf1 specifically binds toThe upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and activates those genes.Irf1 acts as a tumor suppressor.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IRF1 (11 products)

Catalog No. Species Pres. Purity   Source  

IRF1

IRF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

IRF1 (1-114, His-tag)

IRF1 Human Purified ≥ 90 by SDS-PAGE E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

IRF1 (1-114, His-tag)

IRF1 Human Purified ≥ 90 by SDS-PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

IRF1

IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

IRF1

IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

IRF1

IRF1 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

IRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF1

SDS-Page: IRF1 Protein [NBC1-18471] - IRF1, 15 kDa (134 aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for IRF1 (2 products)

Catalog No. Species Pres. Purity   Source  

IRF1 293T Cell Transient Overexpression Lysate(Denatured)

IRF1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IRF1 Lysate

Western Blot: IRF1 Lysate [NBL1-12030] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IRF1
  Novus Biologicals Inc.
  • LinkedIn