TA335084 Islet cell autoantigen 1 / ICA1 antibody

Rabbit Polyclonal Anti-ICA1 Antibody

See related secondary antibodies

Search for all "Islet cell autoantigen 1 / ICA1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Islet cell autoantigen 1 / ICA1

Product Description for Islet cell autoantigen 1 / ICA1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Islet cell autoantigen 1 / ICA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Islet cell autoantigen 1 / ICA1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 69 kDa islet cell autoantigen, ICA69, ICAp69, Islet cell autoantigen p69
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ICA1 antibody: synthetic peptide directed towards the C terminal of human ICA1. Synthetic peptide located within the following region: NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA.
Application WB
Background ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Altertively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Islet cell autoantigen 1 / ICA1 (4 products)

Catalog No. Species Pres. Purity   Source  

Islet cell autoantigen 1 / ICA1 (transcript variant 2)

Islet cell autoantigen 1 / ICA1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Islet cell autoantigen 1 / ICA1

Islet cell autoantigen 1 / ICA1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Islet cell autoantigen 1 / ICA1

Islet cell autoantigen 1 / ICA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Islet cell autoantigen 1 / ICA1

Islet cell autoantigen 1 / ICA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Islet cell autoantigen 1 / ICA1 (2 products)

Catalog No. Species Pres. Purity   Source  

ICA1 Lysate

Western Blot: ICA1 Lysate [NBL1-11801] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ICA1
  Novus Biologicals Inc.

ICA1 Lysate

Western Blot: ICA1 Lysate [NBL1-11802] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ICA1
  Novus Biologicals Inc.
  • LinkedIn