TA334313 ISOC1 antibody

Rabbit Polyclonal Anti-ISOC1 Antibody

See related secondary antibodies

Search for all "ISOC1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat ISOC1

Product Description for ISOC1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat ISOC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ISOC1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Isochorismatase domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96CN7
Immunogen:
The immunogen for anti-ISOC1 antibody is: synthetic peptide directed towards the C-terminal region of Human ISOC1. Synthetic peptide located within the following region: DATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNL.
GeneID:
51015
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ISOC1 (2 products)

Catalog No. Species Pres. Purity   Source  

ISOC1 Lysate

Western Blot: ISOC1 Lysate [NBL1-12053] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ISOC1
  Novus Biologicals Inc.

ISOC1 overexpression lysate

ISOC1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn