TA336137 ITPRIPL1 / KIAA1754L antibody

Rabbit Polyclonal Anti-KIAA1754L Antibody

See related secondary antibodies

Search for all "ITPRIPL1 / KIAA1754L"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Rat ITPRIPL1 / KIAA1754L

Product Description for ITPRIPL1 / KIAA1754L

Rabbit anti Bovine, Canine, Human, Rat ITPRIPL1 / KIAA1754L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ITPRIPL1 / KIAA1754L

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 4, 5-triphosphate receptor-interacting protein-like 1, Inositol 1
Presentation Purified
Reactivity Bov, Can, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-KIAA1754L Antibody: synthetic peptide directed towards the C terminal of human KIAA1754L. Synthetic peptide located within the following region: EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT.
Application WB
Background The function remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Positive controls for ITPRIPL1 / KIAA1754L (2 products)

Catalog No. Species Pres. Purity   Source  


Western Blot: ITPRIPL1 Lysate [NBL1-12279] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ITPRIPL1
  Novus Biologicals Inc.

ITPRIPL1 overexpression lysate

ITPRIPL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn