F-MKA0742AF JMJD1A antibody

See related secondary antibodies

Search for all "JMJD1A"

50 µg / €680.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse JMJD1A

F-MKA0742AF

Product Description for JMJD1A

Rabbit anti Mouse JMJD1A.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for JMJD1A

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Germany only
PDF datasheet View Datasheet
Manufacturer Funakoshi Co., Ltd.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PCM1
Immunogen:
GX0988 (GST-fusion protein, 167 amino acids)SDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQDNPADHDPIHDQSWYLDRSLRKRLYQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSLGKP.
GeneID:
104263
Add. information Shipping conditions: Dry Ice
Storage -20℃
Format
State:
Aff - Purified

Accessory Products

  • LinkedIn