discontinued

NBP1-74121 JNK3 antibody

See related secondary antibodies

Search for all "JNK3"

50 µg / €390.00

Quick Overview

Rabbit anti Rat JNK3

NBP1-74121

Product Description for JNK3

Rabbit anti Rat JNK3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for JNK3

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B0VXR6
Immunogen:
Synthetic peptides corresponding to the N terminal of Mapk10. Immunizing peptide sequence RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL.
Background Mapk10 is a stress-activated protein kinase.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
State:
Aff - Purified

Accessory Products

  • LinkedIn