NBP1-87106 KAAG1 antibody

See related secondary antibodies

Search for all "KAAG1"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human KAAG1

Product Description for KAAG1

Rabbit anti Human KAAG1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for KAAG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Kidney-associated antigen 1, RU2 antisense gene protein, RU2AS
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBP8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKE
GeneID:
353219
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 353219

Accessory Products

Proteins and/or Positive Controls

Proteins for KAAG1 (5 products)

Catalog No. Species Pres. Purity   Source  

KAAG1 (1-84, His-tag)

KAAG1 Human Purified > 90 % E. coli
50 µg / €750.00
  Acris Antibodies GmbH

KAAG1 (1-84, His-tag)

KAAG1 Human Purified > 90 % E. coli
10 µg / €300.00
  Acris Antibodies GmbH

KAAG1

KAAG1 Human
10 µg / €380.00
  Abnova Taiwan Corp.

KAAG1

KAAG1 Human
0.1 mg / €330.00
  Abnova Taiwan Corp.

Kidney associated antigen 1 (KAAG1)

Kidney associated antigen 1 (KAAG1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for KAAG1 (1 products)

Catalog No. Species Pres. Purity   Source  

KAAG1 overexpression lysate

KAAG1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn