NBP1-52906 KAT3A/CBP antibody

See related secondary antibodies

Search for all "KAT3A/CBP"

Quick Overview

Rabbit anti Human, Mouse, Rat KAT3A/CBP

Product Description for KAT3A/CBP

Rabbit anti Human, Mouse, Rat KAT3A/CBP.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for KAT3A/CBP

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CBP, RTS
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CREBBP(CREB binding protein (Rubinstein-Taybi syndrome)) The peptide sequence was selected from the N terminal of CREBBP. Peptide sequence TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS.
Background CREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex. This protein acetylates both histone and non-histone proteins. This protein shares regions of very high sequence similarity with protein p300 in its bromodomain, cysteine-histidine-rich regions, and histone acetyltransferase domain.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 1387

Accessory Products

  • LinkedIn