TA343579 KBTBD10 antibody

Rabbit Polyclonal Anti-KBTBD10 Antibody

See related secondary antibodies

Search for all "KBTBD10"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KBTBD10

Product Description for KBTBD10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KBTBD10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KBTBD10

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms KBTBD10, KRP1, Kel-like protein 23, Kelch repeat and BTB domain-containing protein 10, Kelch-related protein 1, Sarcosin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-KBTBD10 antibody: synthetic peptide directed towards the C terminal of human KBTBD10. Synthetic peptide located within the following region: AGSLYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASG.
Application WB
Background KBTBD10 contains 1 BTB (POZ) domain and is required for pseudopod elongation in transformed cells. KBTBD10 mR is up-regulated by less than two folds in the heart in human patients with HCM.
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for KBTBD10 (3 products)

Catalog No. Species Pres. Purity   Source  


KBTBD10 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.


KBTBD10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


KBTBD10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KBTBD10 (1 products)

Catalog No. Species Pres. Purity   Source  

KLHL41 overexpression lysate

KLHL41 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn