H00055709-B01P KBTBD4 antibody

See related secondary antibodies

Search for all "KBTBD4"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KBTBD4

H00055709-B01P

Product Description for KBTBD4

Mouse anti Human KBTBD4.
Product is tested for Western blot / Immunoblot.

Properties for KBTBD4

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms BKLHD4, FLJ10450, HSPC252
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVX7
Immunogen:
KBTBD4 (ADZ15413.1, 1 a.a. ~ 518 a.a) full-length human protein.
AA Sequence:
MESPEEPGASMDENYFVNYTFKDRSHSGRVAQGIMKLCLEEELFADVTISVEGREFQLHRLVLSAQSCFFRSMFTS NLKEAHNRVIVLQDVSESVFQLLVDYIYHGTVKLRAEELQEIYEVSDMYQLTSLFEECSRFLARTVQVGNCLQVMW LADRHSDPELYTAAKHCAKTHLAQLQNTEEFLHLPHRLLTDIISDGVPCSQNPTEAIEAWINFNKEEREAFAESLR TSLKEIGENVHIYLIGKESSRTHSLAVSLHCAEDDSISVSGQNSLCHQITAACKHGGDLYVVGGSIPRRMWKCNNA TVDWEWCAPLPRDRLQHTLVSVPGKDAIYSLGGKTLQDTLSNAVIYYRVGDNVWTETTQLEVAVSGAAGANLNGII YLLGGEENDLDFFTKPSRLIQCFDTETDKCHVKPYVLPFAGRMHAAVHKDLVFIVAEGDSLVCYNPLLDSFTRLCL PEAWSSAPSLWKIASCNGSIYVFRDRYKKGDANTYKLDPATSAVTVTRGIKVLLTNLQFVLA
GeneID:
55709
Add. information Mouse polyclonal antibody raised against a full-length human KBTBD4 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for KBTBD4 (1 products)

Catalog No. Species Pres. Purity   Source  

Kelch repeat and BTB (POZ) domain containing 4 (KBTBD4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag)

Kelch repeat and BTB (POZ) domain containing 4 (KBTBD4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for KBTBD4 (4 products)

Catalog No. Species Pres. Purity   Source  

KBTBD4 Lysate

Western Blot: KBTBD4 Lysate [NBL1-12132] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KBTBD4
0.1 mg / €400.00
  Novus Biologicals Inc.

KBTBD4 overexpression lysate

KBTBD4 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

KBTBD4 overexpression lysate

KBTBD4 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

KBTBD4 overexpression lysate

KBTBD4 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn