TA338765 KCNH7 antibody

Rabbit Polyclonal Anti-KCNH7 Antibody

See related secondary antibodies

Search for all "KCNH7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KCNH7

Product Description for KCNH7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KCNH7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNH7

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms ERG3, Eag-related protein 3, Ether-a-go-go-related gene potassium channel 3, Ether-a-go-go-related protein 3, HERG-3, KCNH7, Potassium voltage-gated channel subfamily H member 7, Voltage-gated potassium channel subunit Kv11.3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the N terminal of human KCNH7. Synthetic peptide located within the following region: PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV.
Application WB
Background Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functiol and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neurol excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. There are at least two altertively spliced transcript variants derived from this gene and encoding distinct isoforms. [provided by RefSeq, Jul 2008].
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for KCNH7 (2 products)

Catalog No. Species Pres. Purity   Source  


KCNH7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


KCNH7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KCNH7 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNH7 overexpression lysate

KCNH7 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn