73-087 KCNMB2 antibody

See related secondary antibodies

Search for all "KCNMB2"

5 ml / €460.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

NeuroMab

Quick Overview

Mouse anti Human, Mouse, Rat KCNMB2 N53/32

73-087

More Views

  • 73-087

Product Description for KCNMB2

Mouse anti Human, Mouse, Rat KCNMB2 N53/32.
Presentation: Supernatant
Product is tested for Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Western blot / Immunoblot.

Properties for KCNMB2

Product Category Primary Antibodies
Target Category
Quantity 5 ml
Synonyms BK channel subunit beta-2, BKbeta2, Calcium-activated potassium channel subfamily M subunit beta-2, Calcium-activated potassium channel subunit beta-2, Charybdotoxin receptor subunit beta-2, Hbeta2, Hbeta3, K(VCA)beta-2, Maxi K channel subunit beta-2, Slo-beta-2
Presentation Supernatant
Reactivity Hu, Ms, Rt
Applications ICC/IF, IP, WB
Clonality Monoclonal
Clone N53/32
Host Mouse
Isotype IgG1
Molecular weight 27 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Antibodies Incorporated

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9CZM9
Immunogen:
Fusion protein amino acids 1-41 (MFIWTSGRTSSSYRQDEKRNIYQKIRDHDLLDKRKTVTALK, cytoplasmic N-terminus) and 218-235 (KLTQYLSLLCERIQRINR, cytoplasmic C-terminus) of mouse BKBeta2 (also known as BK channel subunit beta-2, Calcium-activated potassium channel subunit beta-2, Calcium-activated potassium channel, subfamily M subunit beta-2, Charybdotoxin receptor subunit beta-2, K(VCA)beta-2, Maxi K channel subunit beta-2, Slobeta-2 and Kcnmb2, accession number Q9CZM9).
Human: 97% and 100% identity (40/41 and 18/18 amino acids identical, respectively)
Rat: 97% and 100% identity (40/41 and 18/18 amino acids identical, respectively)
<50% identity with other BKBeta subunits
GeneID:
72413
Add. information USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
Application Immunoblot (IB)
Immunocytochemistry (ICC)
Immunoprecipitation (IP)
Format
State:
Supernatant
Specificity
Specificity:
No cross-reactivity against BKBeta1, BKBeta3 or BKBeta4

Accessory Products

  • LinkedIn