discontinued

H00010242-B01 KCNMB2 antibody

See related secondary antibodies

Search for all "KCNMB2"

Quick Overview

Mouse anti Human KCNMB2

Product Description for KCNMB2

Mouse anti Human KCNMB2.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for KCNMB2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms BK channel subunit beta-2, BKbeta2, Calcium-activated potassium channel subfamily M subunit beta-2, Calcium-activated potassium channel subunit beta-2, Charybdotoxin receptor subunit beta-2, Hbeta2, Hbeta3, K(VCA)beta-2, Maxi K channel subunit beta-2, Slo-beta-2
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y691
Immunogen:
KCNMB2 (NP_005823, 1 a.a. ~ 235 a.a) full-length human protein.
AA Sequence:
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLLRSYMQS VWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNF EESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCE RIQRINR
GeneID:
10242
Remarks:
Gene Accession: NM_005832
Add. information Mouse polyclonal antibody raised against a full-length human KCNMB2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10242

Accessory Products

Proteins and/or Positive Controls

Proteins for KCNMB2 (2 products)

Catalog No. Species Pres. Purity   Source  

KCNMB2

KCNMB2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KCNMB2

KCNMB2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for KCNMB2 (3 products)

Catalog No. Species Pres. Purity   Source  

KCNMB2 Lysate(Denatured)

KCNMB2 Lysate(Denatured)
  Abnova Taiwan Corp.

KCNMB2 Lysate

Western Blot: KCNMB2 Lysate [NBL1-12191] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KCNMB2
  Novus Biologicals Inc.

KCNMB2 Lysate

Western Blot: KCNMB2 Lysate [NBL1-12192] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KCNMB2
  Novus Biologicals Inc.
  • LinkedIn