TA338717 KCTD10 antibody

Rabbit Polyclonal Anti-KCTD10 Antibody

See related secondary antibodies

Search for all "KCTD10"

0.1 mg / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KCTD10

Product Description for KCTD10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KCTD10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCTD10

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms BTB/POZ domain-containing protein KCTD10, MSTP028, ULR061
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-KCTD10 antibody: synthetic peptide directed towards the N terminal of human KCTD10. Synthetic peptide located within the following region: MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL.
Application WB
Background Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex. The BCR(BACURD3) E3 ubiquitin ligase complex mediates the ubiquitition of target proteins, leading to their degradation by the proteasome.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for KCTD10 (1 products)

Catalog No. Species Pres. Purity   Source  


KCTD10 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for KCTD10 (1 products)

Catalog No. Species Pres. Purity   Source  

KCTD10 Lysate

Western Blot: KCTD10 Lysate [NBL1-12207] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KCTD10
  Novus Biologicals Inc.
  • LinkedIn