TA337230 Kelch-like protein 26 antibody

Rabbit Polyclonal Anti-Klhl26 Antibody

See related secondary antibodies

Search for all "Kelch-like protein 26"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Kelch-like protein 26

Product Description for Kelch-like protein 26

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Kelch-like protein 26.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Kelch-like protein 26

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KLHL26
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-Klhl26 antibody is synthetic peptide directed towards the N-terminal region of Mouse Klhl26. Synthetic peptide located within the following region: GQLLDVVLTVNSEAFHAHKVVLAACSDYFRAMFTGGMREANQAVIQLQGV.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Kelch-like protein 26 (1 products)

Catalog No. Species Pres. Purity   Source  

Kelch-like protein 26

Kelch-like protein 26 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn