NBP1-94158 KIAA0408 antibody

See related secondary antibodies

Search for all "KIAA0408"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human KIAA0408

NBP1-94158

More Views

  • NBP1-94158

Product Description for KIAA0408

Rabbit anti Human KIAA0408.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for KIAA0408

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZU52
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SCGFERTTRNEKLAAKTDEFNRTVFRTDRNCQAIQQNHSCSKSSEDLKPCDTSSTHTGSISQSNDVSGIWKTNAHMPVPMENVPDNPTKKS
GeneID:
9729
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 9729

Accessory Products

Proteins and/or Positive Controls

Positive controls for KIAA0408 (2 products)

Catalog No. Species Pres. Purity   Source  

KIAA0408 Lysate

Western Blot: KIAA0408 Lysate [NBL1-12246] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KIAA0408
0.1 mg / €400.00
  Novus Biologicals Inc.

KIAA0408 overexpression lysate

KIAA0408 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn