NBP1-90929 KIAA0753 antibody

See related secondary antibodies

Search for all "KIAA0753"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human KIAA0753

NBP1-90929

More Views

  • NBP1-90929
  • NBP1-90929

Product Description for KIAA0753

Rabbit anti Human KIAA0753.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for KIAA0753

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2KHM9
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LKAEEMYRLQQLSVSATHLADKVEEAVLDRLKPLLVKAQRVNSTTEANIHLKDGSSVNTAKAQPAQEVAAVDFESNNIRQLDDFLEDCASELWAVTHAKILGSE
GeneID:
9851
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 9851

Accessory Products

Proteins and/or Positive Controls

Positive controls for KIAA0753 (1 products)

Catalog No. Species Pres. Purity   Source  

KIAA0753 overexpression lysate

KIAA0753 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn