H00055683-B01P KIAA1310 antibody

See related secondary antibodies

Search for all "KIAA1310"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KIAA1310

H00055683-B01P

Product Description for KIAA1310

Mouse anti Human KIAA1310.
Product is tested for Western blot / Immunoblot.

Properties for KIAA1310

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ10081, FLJ23799
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P2N6
Immunogen:
KIAA1310 (NP_060461.3, 1 a.a. ~ 791 a.a) full-length human protein.
AA Sequence:
MPLYDNQKARSVMNECERHVIFARTDADAPPPPEDWEEHVNRTGWTMAQNKLFNKILKALQSDRLARLANEGACNE PVLRRVAVDKCARRVRQALASVSWDTKLIQWLHTTLVETLSLPMLAAYLDALQTLKGKIPTLIDRMLVSSNTKTGA AGAEALSLLLKRPWDPAVGVLSHNKPSKLPGSPLILIASSGPSSSVFPTSRRHRFWQSQLSCLGKVIPVATHLLNN GSGVGVLQCLEHMIGAVRSKVLEIHSHFPHKPIILIGWNTGALVACHVSVMEYVTAVVCLGFPLLTVDGPRGDVDD PLLDMKTPVLFVIGQNSLQCHPEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDF LTGVLTRAEGHMGSEPRDQDAEKKKKPRDVARRDLAFEVPERGSRPASPAAKLPASPSGSEDLSSVSSSPTSSPKT KVTTVTSAQKSSQIGSSQLLKRHVQRTEAVLTHKQAQVPISSEPPEEGEKEDLRVQLKRHHPSSPLPGSKTSKRPK IKVSLISQGDTAGGPCAPSQGSAPEAAGGKPITMTLGQASAGAKELTGLLTTAKSSSSEGGVSASPVPSVVSSSTA PSALHTLQSRLVATSPGSSLPGATSASSLLQGLSFSLQDISSKTSGLPANPSPGPAPQATSVKLPTPMQSLGAITT GTSTIVRTIPVATTLSSLGATPGGKPTAIHQLLTNGGLAKLASSLPGLAQISNQASGLKVPTTITLTLRGQPSRIT TLSPMGSGAAPSEESSSQVLPSSSQRLPPAP
GeneID:
55683
Add. information Mouse polyclonal antibody raised against a full-length human KIAA1310 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for KIAA1310 (1 products)

Catalog No. Species Pres. Purity   Source  

KIAA1310 Lysate

Western Blot: KIAA1310 Lysate [NBL1-12264] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KIAA1310
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn