F-MKA1549AF KIAA1549 antibody

See related secondary antibodies

Search for all "KIAA1549"

50 µg / €680.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse KIAA1549

F-MKA1549AF

Product Description for KIAA1549

Rabbit anti Mouse KIAA1549.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA1549

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Germany only
PDF datasheet View Datasheet
Manufacturer Funakoshi Co., Ltd.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68FD9
Immunogen:
GX0620 (GST-fusion protein, 190 amino acids)LDPAASVPSVFIEPRKSSRMKRSPKPRRKHQVNGCPADAEKDRLITTDSDGTYKRPPGVHNSAYIGCPSDPDLPADVQTPSSTELGRYPGLPFSASQYIPPQPSIEEARQTMHSLLDDAFALVAPSSQPTNAMGAGTGVPASLPVNSTPSREERRATQWGSFYSPAQTANNPCSRYEDYGMTPPSGPLPR.
GeneID:
330286
Add. information Shipping conditions: Dry Ice
Storage -20℃
Format
State:
Aff - Purified

Accessory Products

  • LinkedIn