H00284900-B01P KIAA1648 antibody

See related secondary antibodies

Search for all "KIAA1648"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KIAA1648

H00284900-B01P

Product Description for KIAA1648

Mouse anti Human KIAA1648.
Product is tested for Western blot / Immunoblot.

Properties for KIAA1648

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms dJ353E16.2
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
KIAA1648 (CAK54441.1, 1 a.a. ~ 240 a.a) full-length human protein.
AA Sequence:
MTMAVVASVCRNDLPSSREGAAPVGRRCLPSQMETAGKWHLFPPGVEMLVSGTPCHFSGHPPAPSWEIQHPHECGA QGHQLFHLLSARPVAPALHPQLTQQGLECAAALLEPVARVGGWEEDSRWQATGWGVQPEAHSGEEGLPARDAAHFV LHTLLGRVHGIALPILDALQGFLHLRGNWGKHWDAGAQASQTGGSVYSHQPGGNKPAWEDRRSALAVPQERGASKA HCPLGQGVSRRS
GeneID:
284900
Add. information Mouse polyclonal antibody raised against a full-length human KIAA1648 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn