NBP1-58181 KIF12 antibody

See related secondary antibodies

Search for all "KIF12"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human KIF12

Product Description for KIF12

Rabbit anti Human KIF12.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for KIF12

Product Category Primary Antibodies
Quantity 50 µg
Synonyms RP11-56P10.3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B1ALC3
Immunogen:
Synthetic peptides corresponding to KIF12(kinesin family member 12) The peptide sequence was selected from the N terminal of KIF12. Peptide sequence SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH.
GeneID:
113220
Background KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors that play important roles in intracellular transport and cell division.KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors (see MIM 148760) that play important roles in intracellular transport and cell division (Nakagawa et al., 1997 [PubMed 9275178]).[supplied by OMIM].
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 113220

Accessory Products

  • LinkedIn