discontinued

NBP1-58181 KIF12 antibody

See related secondary antibodies

Search for all "KIF12"

Quick Overview

Rabbit anti Human KIF12

Product Description for KIF12

Rabbit anti Human KIF12.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for KIF12

Product Category Primary Antibodies
Quantity 50 µg
Synonyms RP11-56P10.3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B1ALC3
Immunogen:
Synthetic peptides corresponding to KIF12(kinesin family member 12) The peptide sequence was selected from the N terminal of KIF12. Peptide sequence SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH.
GeneID:
113220
Background KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors that play important roles in intracellular transport and cell division.KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors (see MIM 148760) that play important roles in intracellular transport and cell division (Nakagawa et al., 1997 [PubMed 9275178]).[supplied by OMIM].
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 113220

Accessory Products

  • LinkedIn