H00003803-B01P KIR2DL2 antibody

See related secondary antibodies

Search for all "KIR2DL2"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KIR2DL2

H00003803-B01P

Product Description for KIR2DL2

Mouse anti Human KIR2DL2.
Product is tested for Western blot / Immunoblot.

Properties for KIR2DL2

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms CD158B1, CD158b, NKAT6, p58.2
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P43627
Immunogen:
KIR2DL2 (AAI52937.1, 1 a.a. ~ 348 a.a) full-length human protein.
AA Sequence:
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEH HDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSR SSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSW PSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQ LNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
GeneID:
3803
Add. information Mouse polyclonal antibody raised against a full-length human KIR2DL2 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn