H00553128-B01P KIR2DL5B antibody

See related secondary antibodies

Search for all "KIR2DL5B"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KIR2DL5B

H00553128-B01P

Product Description for KIR2DL5B

Mouse anti Human KIR2DL5B.
Product is tested for Western blot / Immunoblot.

Properties for KIR2DL5B

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms KIR2DL5, KIR2DL5.2, KIR2DLX
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NHK4
Immunogen:
KIR2DL5B (NP_001018091.1, 1 a.a. ~ 375 a.a) full-length human protein.
AA Sequence:
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIF WKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVALSCSSRSSFDM YHLSREGRAHEPRLPAVPSVDGTFQADFPLGPATHGGTYTCFSSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTE PSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQGPAGDRTVNREDSDDQDPQEVTYAQLDHC VFTQTKITSPSQRPKAPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
GeneID:
553128
Add. information Mouse polyclonal antibody raised against a full-length human KIR2DL5B protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for KIR2DL5B (1 products)

Catalog No. Species Pres. Purity   Source  

KIR2DL5B overexpression lysate

KIR2DL5B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn