H00003810-B01P KIR2DS5 antibody

See related secondary antibodies

Search for all "KIR2DS5"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KIR2DS5

H00003810-B01P

Product Description for KIR2DS5

Mouse anti Human KIR2DS5.
Product is tested for Western blot / Immunoblot.

Properties for KIR2DS5

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms CD158G, NKAT9
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7L8K3
Immunogen:
KIR2DS5 (AAI60061.1, 1 a.a. ~ 304 a.a) full-length human protein.
AA Sequence:
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEH IDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSR SSYDMYHLSREGEAHERRLPAGPKVNRTFQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSW PSPTEPSSETGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQEVSYA
GeneID:
3810
Add. information Mouse polyclonal antibody raised against a full-length human KIR2DS5 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn