H00283165-B01P KIRREL3-AS3 antibody

See related secondary antibodies

Search for all "KIRREL3-AS3"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KIRREL3-AS3

H00283165-B01P

Product Description for KIRREL3-AS3

Mouse anti Human KIRREL3-AS3.
Product is tested for Western blot / Immunoblot.

Properties for KIRREL3-AS3

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ40224
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N7Y1
Immunogen:
KIRREL3-AS3 (ADR82890.1, 1 a.a. ~ 241 a.a) full-length human protein.
AA Sequence:
MEKRGESLDLGVRCKRGEERDRRPCWKPSRPGAARGGRGLWTVGGGGSPTETAESQQLGKPPEFWVSAHPGWLQVS CAHRASRWDASRWHPLQRFFARRGVRRPNPSVPSPLPKPPVPSAGSCEPLAPPPTSASGASRSWVTQTLAEAGAYR GCRPAPGSAAGWPRSDRRARLPRKASKPCSPALPSLAACCPQGFLRSGTKRVMCKVLGPGAGVRGTAVECSEQAGV WAHCRPQLTATFS
GeneID:
283165
Add. information Mouse polyclonal antibody raised against a full-length human KIRREL3-AS3 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn