48530002 kle-2 antibody

See related secondary antibodies

Search for all "kle-2"

50 µl / €640.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti C. elegans kle-2

Product Description for kle-2

Rabbit anti C. elegans kle-2.
Presentation: Aff - Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for kle-2

Product Category Primary Antibodies
Quantity 50 µl
Synonyms KLE2
Presentation Aff - Purified
Reactivity Ce
Applications E, WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P34341
Immunogen:
In vivo generated recominant protein fragment: MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK
GeneID:
176116
Concentration 1 mg/ml
Storage Store at 4C. Do not freeze.
Format
Purification:
Affinity purified
Buffer System:
20 mM Potassium Phosphate, 150 mM Sodium Chloride, pH 7.0
State:
Aff - Purified
Gene ID 176116

Accessory Products

  • LinkedIn