H00113730-B01P KLHDC7B antibody

See related secondary antibodies

Search for all "KLHDC7B"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KLHDC7B

H00113730-B01P

Product Description for KLHDC7B

Mouse anti Human KLHDC7B.
Product is tested for Western blot / Immunoblot.

Properties for KLHDC7B

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC16635
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96G42
Immunogen:
KLHDC7B (NP_612442.1, 1 a.a. ~ 495 a.a) full-length human protein.
AA Sequence:
MPRGPAQPPAQRPPGPAASSSARRSQPVPQLRKRSRCEIAPSSEQEVRPAASGDPQGEAPGEGGSPAGRSGALTEK QEEARKLMVFLQRPGGWGVVEGPRKPSSRALEPATAAALRRRLDLGSCLDVLAFAQQHGEPGLAQETYALMSDNLL RVLGDPCLYRRLSAADRERILSLRTGRGRAVLGVLVLPSLYQGGRSGLPRGPRGEEPPAAAPVSLPLPAHLHVFNP RENTWRPLTQVPEEAPLRGCGLCTMHNYLFLAGGIRGSGAKAVCSNEVFCYNPLTNIWSQVRPMQQARAQLKLVAL DGLLYAIGGECLYSMECYDPRTDAWTPRAPLPAGTFPVAHEAVACRGDIYVTGGHLFYRLLRYSPVKDAWDECPYS ASHRRSSDIVALGGFLYRFDLLRGVGAAVMRYNTVTGSWSRAASLPLPAPAPLHCTTLGNTIYCLNPQVTATFTVS GGTAQFQAKELQPFPLGSTGVLSPFILTLPPEDRLQTSL
GeneID:
113730
Add. information Mouse polyclonal antibody raised against a full-length human KLHDC7B protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for KLHDC7B (1 products)

Catalog No. Species Pres. Purity   Source  

Kelch domain containing 7B (KLHDC7B)

Kelch domain containing 7B (KLHDC7B) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for KLHDC7B (2 products)

Catalog No. Species Pres. Purity   Source  

KLHDC7B Lysate

Western Blot: KLHDC7B Lysate [NBL1-12328] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KLHDC7B
0.1 mg / €400.00
  Novus Biologicals Inc.

KLHDC7B overexpression lysate

KLHDC7B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn